¿Mantener la sesión abierta?
Finalizando en 
Su sesión ha finalizado
Su sesión ha caducado. Por seguridad lo hemos desconectado.
¿Quiere conectarse de nuevo?

Anti-SPA17 Mouse Polyclonal Antibody

Proveedor: US Biological
Recommended dilution: Immunofluorescence: 10 μg/ml; Immunochemistry: 3μg/ml

Type: Primary
Antigen: SPA17 (sperm autoantigenic protein 17)
Clonality: polyclonal
Clone:
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG
Reactivity: Human




 

PEDIDO

Abrir todos / Contraer todo
Tamaño Env Núm. Catálogo VWR Cantidad
50 µg 50 µG USBI133738
Generate Barcodes Barcode Label Format: 
Generar página de catálogo en PDF

ESPECIFICACIONES

Antigen symbol SPA17
Antigen name sperm autoantigenic Protein 17
Reactivity Human
Conjugation Unconjugated
Clonality Polyclonal
Antibody type Primary
Host Mouse
Isotype IgG
Western blot Yes
ImmunoFluorescence Yes
Amino acid number 1 to 151
Purification purified by Protein A chromatography
Sequence MSIPFSNTHYRIPQGFGNLLEGLTREILREQPDNIPAFAAAYFESLLEKREKTNFDPAEWGSKVEDRFYNNHAFEEQEPPEKSDPKQEESQISGKEEETSVTILDSSEEDKEKEEVAAVKIQAAFRGHIAREEAKKMKTNSLQNEEKEENK
Forma liquid
Storage buffer PBS, pH 7,2.
Temperatura de almacenamiento Cool
Shipping temperature Ice
Enter Details

Select the article for which you are looking for Certificate

Indicar núm. de lote (campo obligatorio). Introduzca 'x' si lo desconoce para productos VWR Chemicals

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

O
Revise y compare las alternativas
Disponemos de alternativas con las que puede ahorrar hasta  por producto unitario.  Para comparar detalles de los productos, seleccione hasta 3 alternativas y haga clic en comparar seleccionados. Para añadir productos a su cesta, introduzca la cantidad y haga clic en Añadir a la cesta.

Producto Original:

Descripción Numero del catalogo Disponibilidad Unidad Su precio Precio Por Uds.
 

Una imagen y un compromiso renovados

Creado a partir de las funciones y los recursos que conoce, optimizado con la innovación de Avantor®. Nuestra nueva marca representa nuestra agilidad y capacidad para adaptarnos a las necesidades del cliente.

MÁS INFORMACIÓN COMPRAR