¿Mantener la sesión abierta?
Finalizando en 
Su sesión ha finalizado
Su sesión ha caducado. Por seguridad lo hemos desconectado.
¿Quiere conectarse de nuevo?

Anti-SP3 Mouse Monoclonal Antibody [clone: 3H7]

Proveedor: US Biological
Recommended dilution: Immunofluorescence: 10 μg/ml

Type: Primary
Antigen: SP3 (Sp3 transcription factor)
Clonality: monoclonal
Clone: 3H7
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b Kappa
Reactivity: Human




 

PEDIDO

Abrir todos / Contraer todo
Tamaño Env Núm. Catálogo VWR Cantidad
100 µg 100 µG USBI133736
Generate Barcodes Barcode Label Format: 
Generar página de catálogo en PDF

ESPECIFICACIONES

Antigen symbol SP3
Antigen name Sp3 transcription factor
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 3H7
Host Mouse
Isotype IgG2b kappa
Western blot Yes
ELISA Yes
ImmunoFluorescence Yes
Amino acid number 516 to 616
Purification purified by Protein A chromatography
Sequence GQLPNLQTVTVNSIDSAGIQLHPGENADSPADIRIKEEEPDPEEWQLSGDSTLNTNDLTHLRVQVVDEEGDQQHQEGKRLRRVACTCPNCKEGGGRGTNL*
Forma liquid
Storage buffer PBS, pH 7,2.
Temperatura de almacenamiento Cool
Shipping temperature Ice
Enter Details

Select the article for which you are looking for Certificate

Indicar núm. de lote (campo obligatorio). Introduzca 'x' si lo desconoce para productos VWR Chemicals

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

O
Revise y compare las alternativas
Disponemos de alternativas con las que puede ahorrar hasta  por producto unitario.  Para comparar detalles de los productos, seleccione hasta 3 alternativas y haga clic en comparar seleccionados. Para añadir productos a su cesta, introduzca la cantidad y haga clic en Añadir a la cesta.

Producto Original:

Descripción Numero del catalogo Disponibilidad Unidad Su precio Precio Por Uds.
 

Una imagen y un compromiso renovados

Creado a partir de las funciones y los recursos que conoce, optimizado con la innovación de Avantor®. Nuestra nueva marca representa nuestra agilidad y capacidad para adaptarnos a las necesidades del cliente.

MÁS INFORMACIÓN COMPRAR