¿Mantener la sesión abierta?
Finalizando en 
Su sesión ha finalizado
Su sesión ha caducado. Por seguridad lo hemos desconectado.
¿Quiere conectarse de nuevo?

Anti-SOX10 Mouse Monoclonal Antibody [clone: 1E6]

Proveedor: US Biological
Recommended dilution: Immunochemistry: 1. 5 μg/ml

Type: Primary
Antigen: SOX10 (SRY (sex determining region Y)-box 10)
Clonality: monoclonal
Clone: 1000000
Conjugation: unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a Kappa
Reactivity: Human




 

PEDIDO

Abrir todos / Contraer todo
Tamaño Env Núm. Catálogo VWR Cantidad
100 µg 100 µG USBI133713
Generate Barcodes Barcode Label Format: 
Generar página de catálogo en PDF

ESPECIFICACIONES

Antigen symbol SOX10
Antigen name SRY (sex determining region Y)-box 10
Reactivity Human
Conjugation Unconjugated
Clonality Monoclonal
Antibody type Primary
Clone 1E6
Host Mouse
Isotype IgG2a kappa
Western blot Yes
ELISA Yes
Amino acid number 336 to 434
Purification purified by Protein A chromatography
Sequence KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR*
Forma liquid
Storage buffer PBS, pH 7,2.
Temperatura de almacenamiento Cool
Shipping temperature Ice
Enter Details

Select the article for which you are looking for Certificate

Indicar núm. de lote (campo obligatorio). Introduzca 'x' si lo desconoce para productos VWR Chemicals

Enter Certificate Details

Enter the Lot number:

Choose from recent batch/lot numbers:

O
Revise y compare las alternativas
Disponemos de alternativas con las que puede ahorrar hasta  por producto unitario.  Para comparar detalles de los productos, seleccione hasta 3 alternativas y haga clic en comparar seleccionados. Para añadir productos a su cesta, introduzca la cantidad y haga clic en Añadir a la cesta.

Producto Original:

Descripción Numero del catalogo Disponibilidad Unidad Su precio Precio Por Uds.
 

Una imagen y un compromiso renovados

Creado a partir de las funciones y los recursos que conoce, optimizado con la innovación de Avantor®. Nuestra nueva marca representa nuestra agilidad y capacidad para adaptarnos a las necesidades del cliente.

MÁS INFORMACIÓN COMPRAR